Recombinant Full Length Xenopus Laevis Protein Odr-4 Homolog(Odr4) Protein, His-Tagged
Cat.No. : | RFL14442XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein odr-4 homolog(odr4) Protein (A3KNB6) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MGRSYYVDDRVEKYFSKLVQQQKACITGLIIGQYSSQRDYAVLTAQTPQKEDQNEEKKPG LSKLEEIDDEWVSMHASQVGRMLPGGLMVLGVFLMTTPDLSKDAQTILRKLVFAVEKSSM KNRLWNFDEDDVSERVTLHICSSTKKITCRTYDINDPKSTPKPADWKYQNSVLSWLTVDC NVRVDVTIPLTSPSLTYQERQKSIRLGLVKWTKEIEDSVVLFNGQYKDKNGDLFEEQKKS SRSSSHYSPQIITANFLNASPLIDNTRSTALVQPCKSSLTIQGVMKCRGFIHSNRPKVKD AMQAIKRDLLNTIQDRCELLFEDMMLNGPSNENDACPLPQRVFVPINGSNLKLCDYLFGD ETTSDLQSHFLEIMDQEVEQNELDFTEKKCELAHPEKRESEPASQHLESKPENKARSSST SLLNKGLVISTIVASIAIIISFYYIM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | odr4 |
Synonyms | odr4; Protein odr-4 homolog |
UniProt ID | A3KNB6 |
◆ Recombinant Proteins | ||
Kat2b-455M | Active Recombinant Mouse Kat2b, His-tagged | +Inquiry |
IL6-732L | Recombinant Llama IL6 protein, His-tagged | +Inquiry |
ERBB2-920H | Recombinant Human ERBB2 Protein, Flag-tagged | +Inquiry |
TGFB1I1-4500R | Recombinant Rhesus Macaque TGFB1I1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21924AF | Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At1G20180(At1G20180) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA33-8252HCL | Recombinant Human C16orf55 293 Cell Lysate | +Inquiry |
Brain-43R | Rabbit Brain Lysate | +Inquiry |
HA-2364HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
PRPF19-2828HCL | Recombinant Human PRPF19 293 Cell Lysate | +Inquiry |
A431-030HCL | Human A431 Cell Nuclear Extract | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All odr4 Products
Required fields are marked with *
My Review for All odr4 Products
Required fields are marked with *
0
Inquiry Basket