Recombinant Full Length Xenopus Laevis Protein Fam73B(Fam73B) Protein, His-Tagged
Cat.No. : | RFL31014XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein FAM73B(fam73b) Protein (Q6GR21) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MAFQRAEGMSIIQALAMTVAEIPVFLYTTFGQSTFSQLRLSPGLRKVLFATALGTVALAL AAHQLKRRKHKKKQITADNGGLKLGGVPGSVLPVRRSSSAKKGYSRSRVQSPSSKSNDTL SGISSLDPSKHSSSSHSLASVVAVNSSSINAAPAGPWESPEMDETLEEGDSNAENLYIQG MELFEEALHKWEQALNVGQRCRSNTPASQVNDLLNQSCSEGLSEDSQSGHFAGKLEALLY RAYNLQEEFGTSIPPDDLLMDLEGSLIFPLVESRRALMMDDEGSSTSEDSFFSAAELFET LQLNEVPFLPTKPAAAYEEALKLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEV LLLDDGNQLFFGEVGKQMITGLMQKAEKNPKGFLENYEEMLRYALKQDTWATTQRELKGR GVVCMNFFDIALDFILMDAFEDLESPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKR RLLMVPDGFISHFYSVSEHVSPVLAYGFLGPKEHLTEVCNFFKNQIVQYLKDMFDLDNVR YSTIQSLAEDILHLSRRRSDILLGYLGVETVREMNGAVPVQTTEAELDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | miga2 |
Synonyms | miga2; fam73b; Mitoguardin 2; Protein FAM73B |
UniProt ID | Q6GR21 |
◆ Recombinant Proteins | ||
Lcn4-1610M | Recombinant Mouse Lcn4 protein, His & GST-tagged | +Inquiry |
CABS1-3923HF | Recombinant Full Length Human CABS1 Protein, GST-tagged | +Inquiry |
RFL29028PF | Recombinant Full Length Pyrococcus Horikoshii Uncharacterized Protein Ph0614 (Ph0614) Protein, His-Tagged | +Inquiry |
THSD7A-127HL | Recombinant Human THSD7A HEK293T cell lysate | +Inquiry |
GHRH-2185R | Recombinant Rat GHRH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
Lectin-1839S | Active Native Sambucus Nigra Lectin Protein, Cy3 labeled | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPG-3970HCL | Recombinant Human NAPG 293 Cell Lysate | +Inquiry |
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
NUBP2-3661HCL | Recombinant Human NUBP2 293 Cell Lysate | +Inquiry |
PSMC3IP-2762HCL | Recombinant Human PSMC3IP 293 Cell Lysate | +Inquiry |
BPIFA3-8110HCL | Recombinant Human C20orf71 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All miga2 Products
Required fields are marked with *
My Review for All miga2 Products
Required fields are marked with *
0
Inquiry Basket