Recombinant Full Length Pyrococcus Horikoshii Uncharacterized Protein Ph0614 (Ph0614) Protein, His-Tagged
Cat.No. : | RFL29028PF |
Product Overview : | Recombinant Full Length Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614) Protein (O58348) (24-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrococcus Horikoshii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-332) |
Form : | Lyophilized powder |
AA Sequence : | INDNYDLIIVRNDDLIDYLISLPYSHLINAPILPVNPKELDPVTKAQLYSYIQLGRDKVL IIGNTNAVSLDVEKELRDMGFSVTRIGGADRAETAEKLALHFYQNGSKVVILASAWDYGS TLAAAEFAMEYKCPILLTWENQLSPSALRGIEKLNAKIVILVGFGINETIEKTLEGMGYE TYWIGRDIEPPPIETTTSSPPQSSGSKSFFLGMIVTLIILAPVILYLWRRRSERMSEFLE QFNEKELAVLKAIMERGGEVKQEDLPRIVGYSRPTISRIVQDLEKKGIVEREKSGKTFIV RVIKKIKID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PH0614 |
Synonyms | PH0614; Uncharacterized protein PH0614 |
UniProt ID | O58348 |
◆ Recombinant Proteins | ||
CRYBA1-1611R | Recombinant Rat CRYBA1 Protein | +Inquiry |
DLGAP5-2682H | Recombinant Human DLGAP5 Protein, GST-tagged | +Inquiry |
PTPRS-4145H | Recombinant Human PTPRS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL15183LF | Recombinant Full Length Lactococcus Lactis Subsp. Lactis Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
AKAP14-400H | Recombinant Human AKAP14 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-26879TH | Native Human GPT | +Inquiry |
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
MMP7-28205TH | Native Human MMP7 | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Plg-291M | Active Native Mouse glu-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS11D-1798HCL | Recombinant Human TMPRSS11D cell lysate | +Inquiry |
CYP4F11-7103HCL | Recombinant Human CYP4F11 293 Cell Lysate | +Inquiry |
Thymus-734P | Pig Thymus Lysate, Total Protein | +Inquiry |
PRAME-2897HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
GATA6-6009HCL | Recombinant Human GATA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PH0614 Products
Required fields are marked with *
My Review for All PH0614 Products
Required fields are marked with *
0
Inquiry Basket