Recombinant Full Length Xenopus Laevis Gram Domain-Containing Protein 4(Gramd4) Protein, His-Tagged
Cat.No. : | RFL15937XF |
Product Overview : | Recombinant Full Length Xenopus laevis GRAM domain-containing protein 4(gramd4) Protein (A2RV80) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MLKRLDKIRFRGQKRDDFLDLVESPNASDTECGDEIPMKIPPTSLKDTEELKDPAGSGTI IMASGVAEYNRTESDRLNEVKGHLEIALLEKHFLQEELRKLREETNIDTLKQELEKERQR RTELEQKITDIAKTRTDESATQQLSKGPSQTNGADKQRSKTMCYRVQKWFYDKFGEYIED FRFQPEECTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWHSVYTSAIAFII YMNAVWHGWAIPMFLFLAILRLSLNYLIARGWRIQWSIVPQVSETLELPKEDLTVSEKFQ LVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEMTQKLYIGLWAAFVASCFFHYKTIGLC MGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWTSLPTDPQLKERTNATSSRRIQTVYSR GNLASSAPQGVSRDEETGRFHSTKKSSFHEIFSLLETERPLPACETGWRCCLINRDRKMP TDYIRNGILYVTENFLCFESSRSGSSKRNKVIKLTDITDIQKYKVLSVLPGSGMGIAVST PSTQKPLVFGAMVHRDEAFETIFSQYVKITSAVTNSDT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gramd4 |
Synonyms | gramd4; GRAM domain-containing protein 4 |
UniProt ID | A2RV80 |
◆ Recombinant Proteins | ||
SLCO1A1-5250R | Recombinant Rat SLCO1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGLEC8-5809H | Recombinant Human SIGLEC8 Protein (Met1-Ala363), C-Fc tagged | +Inquiry |
TAF3-2537C | Recombinant Chicken TAF3 | +Inquiry |
Spike-1228V | Recombinant MERS-CoV Spike/S1 protein(Met1-Glu725), His-tagged | +Inquiry |
MPXV-0653 | Recombinant Monkeypox Virus NPH1 Protein, Nucleoside triphosphatase I | +Inquiry |
◆ Native Proteins | ||
F9-300R | Native Rat Factor IX | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICAM1-1970RCL | Recombinant Rat ICAM1 cell lysate | +Inquiry |
SCN2B-1280HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
LDOC1L-4782HCL | Recombinant Human LDOC1L 293 Cell Lysate | +Inquiry |
TRIM69-1528HCL | Recombinant Human TRIM69 cell lysate | +Inquiry |
C1orf21-8167HCL | Recombinant Human C1orf21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gramd4 Products
Required fields are marked with *
My Review for All gramd4 Products
Required fields are marked with *
0
Inquiry Basket