Recombinant Full Length Human Gram Domain-Containing Protein 4(Gramd4) Protein, His-Tagged
Cat.No. : | RFL12302HF |
Product Overview : | Recombinant Full Length Human GRAM domain-containing protein 4(GRAMD4) Protein (Q6IC98) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTL IMATGVQDFNRTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQR RMELEQKVQEVLKARTEEQMAQQPPKGQAQASNGAERRSQGLSSRLQKWFYERFGEYVED FRFQPEENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWYSVYTSAIAFTV YMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVPEVSEPVEPPKEDLTVSEKFQ LVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEITQKLYVALWAAFLASCFFPYRLVGLA VGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSSR SYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPT DYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTP STQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GRAMD4 |
Synonyms | GRAMD4; DIP; KIAA0767; GRAM domain-containing protein 4; Death-inducing protein |
UniProt ID | Q6IC98 |
◆ Recombinant Proteins | ||
Klb-4830M | Recombinant Mouse Klb Protein, His (Fc)-Avi-tagged | +Inquiry |
TYR-220H | Recombinant Human Tyrosinase, GST-tagged | +Inquiry |
PYCR1-6125H | Recombinant Human PYCR1 Protein (Ser2-Asp319), N-His tagged | +Inquiry |
YOKU-3486B | Recombinant Bacillus subtilis YOKU protein, His-tagged | +Inquiry |
Wdr36-6978M | Recombinant Mouse Wdr36 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN4R-2585MCL | Recombinant Mouse RTN4R cell lysate | +Inquiry |
SCNN1B-2028HCL | Recombinant Human SCNN1B 293 Cell Lysate | +Inquiry |
ADSS-8994HCL | Recombinant Human ADSS 293 Cell Lysate | +Inquiry |
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
EPHA3-001MCL | Recombinant Mouse EPHA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GRAMD4 Products
Required fields are marked with *
My Review for All GRAMD4 Products
Required fields are marked with *
0
Inquiry Basket