Recombinant Full Length Mouse Gram Domain-Containing Protein 4(Gramd4) Protein, His-Tagged
Cat.No. : | RFL18614MF |
Product Overview : | Recombinant Full Length Mouse GRAM domain-containing protein 4(Gramd4) Protein (Q8CB44) (1-633aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-633) |
Form : | Lyophilized powder |
AA Sequence : | MGIASHSAFRERESSPTGASLDASPRPWDKGLSGREPPRHVQVRPRSAVLNMLRRLDRIR FRGHKREDLLDLAESPNASDTECGDEIPLKTPRPSPRDSEELRDPAGPGTLIMAAGVQDF NRTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNSEMLRQELDRERQRRIELEQKMQ EVLKARSEEQPAQPQQPPKGQSQASNGTGTERRSQGLASRVQKWFYERFGEYIEDFRFQP EENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWYSIYTSAIAFTVYMNAV WHGWAIPMFLFLAILRLSLNYLIARGWRIQWSIVPEVSEAVEPAKEDLTVSEKFQLVLDV AQKAQNLFGKMADILEKIKNLFMWVQPETTQKLYVALWAAFLASCFFPYRLVGLAVGLYA GIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERAGATVSRRLQTASSRSYVSS APAGLSKDEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPTDYIRN GVLYVTENYLCFESSKSGSSKRNKVIKLMDITDIQKYKVLSVLPGSGMGIAVSTPSTQKP LVFGAMVHRDEAFETIFSQYVKITSAAASGGDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gramd4 |
Synonyms | Gramd4; Dip; Kiaa0767; GRAM domain-containing protein 4; Death-inducing protein |
UniProt ID | Q8CB44 |
◆ Recombinant Proteins | ||
CAP18-3520R | Recombinant Rabbit CAP18, GST-tagged | +Inquiry |
YUGJ-2007B | Recombinant Bacillus subtilis YUGJ protein, His-tagged | +Inquiry |
LRG1-142H | Recombinant Human LRG1, Fc tagged | +Inquiry |
IRS2-4611M | Recombinant Mouse IRS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSB-175C | Recombinant Cynomolgus Monkey CTSB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
AMBP-27H | Native Human AMBP | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE4A-3352HCL | Recombinant Human PDE4A 293 Cell Lysate | +Inquiry |
INSIG1-5194HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
DDR1-001HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
USMG5-476HCL | Recombinant Human USMG5 293 Cell Lysate | +Inquiry |
Liver-492C | Chicken Liver Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gramd4 Products
Required fields are marked with *
My Review for All Gramd4 Products
Required fields are marked with *
0
Inquiry Basket