Recombinant Full Length Vibrio Cholerae Serotype O1 Cai-1 Autoinducer Sensor Kinase/Phosphatase Cqss(Cqss) Protein, His-Tagged
Cat.No. : | RFL5505VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 CAI-1 autoinducer sensor kinase/phosphatase CqsS(cqsS) Protein (Q9KM66) (1-686aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-686) |
Form : | Lyophilized powder |
AA Sequence : | MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGLRCAAAVLFGG LVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDWSTIWAMSFMASIFLHILLVH DTRVMALQALFSVLVAYLAVYGLTDFHPTTLIEWQYIPIFLFTYVFGNLCFFRNQISHET KVSIAKTFGAGIAHEMRNPLSALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDLLHQILN EADDVIYSGNNAIDLLLTSIDENRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELE VHQPFDFFGSDTLLTYALFNLLKNAFYYQKEHFSVCISIEQTSEHNLIRVRDNGVGIAPE MLEDIFRDFYTFGKNGSYGLGLPFCRKVMSAFGGTIRCASQQGQWTEFVLSFPRYDSDTV NEIKTELLKTKSLIYIGSNQAIVRELNQLAVEDEFGFTAISAQQAVRRQDYEFEFDLILL DLDDATAQGELLPKLEGTLSFAEGCIGYVYDPGKTYAVNINRYLRIQPISIHSILRKPRK IIERLLFEQESLSMNRNVIPLQKSRHERRILVVDDNQSIRTFTAILLEQQGYEVVQANDG SEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSEHEYKNIPIIGYTGDNSPKTLALV QTSGMNDFIVKPADRDVLLNKVAAWV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cqsS |
Synonyms | cqsS; VC_A0522; CAI-1 autoinducer sensor kinase/phosphatase CqsS; Cholerae quorum-sensing sensor |
UniProt ID | Q9KM66 |
◆ Recombinant Proteins | ||
FGFR3-03H | Recombinant Human Fibroblast Growth Factor Receptor 3, Fc-tagged | +Inquiry |
VIT-10022M | Recombinant Mouse VIT Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMXL2-4902H | Recombinant Human RBMXL2 Protein, GST-tagged | +Inquiry |
TNF-378B | Recombinant Bovine Tumor Necrosis Factor | +Inquiry |
RFL19870HF | Recombinant Full Length Human Transmembrane Protein 54(Tmem54) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
C8-57H | Native Human Complement C8 | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
PDE10A-3355HCL | Recombinant Human PDE10A 293 Cell Lysate | +Inquiry |
SNRPD1-617HCL | Recombinant Human SNRPD1 lysate | +Inquiry |
HENMT1-8151HCL | Recombinant Human C1orf59 293 Cell Lysate | +Inquiry |
SERPINA5-1940HCL | Recombinant Human SERPINA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cqsS Products
Required fields are marked with *
My Review for All cqsS Products
Required fields are marked with *
0
Inquiry Basket