Recombinant Full Length Human Transmembrane Protein 54(Tmem54) Protein, His-Tagged
Cat.No. : | RFL19870HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 54(TMEM54) Protein (Q969K7) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVV NILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTF ATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQL THQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM54 |
Synonyms | TMEM54; BCLP; CAC1; Transmembrane protein 54; Beta-casein-like protein; Protein CAC-1 |
UniProt ID | Q969K7 |
◆ Native Proteins | ||
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIT1-2330HCL | Recombinant Human RIT1 293 Cell Lysate | +Inquiry |
TMEM37-955HCL | Recombinant Human TMEM37 293 Cell Lysate | +Inquiry |
PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
ZIKV-643HCL | Native Zika Virus Lysate | +Inquiry |
TDG-1157HCL | Recombinant Human TDG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM54 Products
Required fields are marked with *
My Review for All TMEM54 Products
Required fields are marked with *
0
Inquiry Basket