Recombinant Full Length Vi Polysaccharide Export Inner-Membrane Protein Vexd(Vexd) Protein, His-Tagged
Cat.No. : | RFL27082SF |
Product Overview : | Recombinant Full Length Vi polysaccharide export inner-membrane protein vexD(vexD) Protein (P43111) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MENSERIKKWKEERAKVAQESRASRLQQKEDERALRQTEKSADAKSHHNPDAGWSATDAD SVRRASLVIKERRVQQAKQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDAS QDNFSGTSFFGAGNKMSEGFQVREFILSKEMMDRMEKELGFLSYFAQDDIALFSRFHAPL GINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQHVNTVSARMQ KERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKA EYAQLMVNGLDQNPLIPRLSAKIKVLEKQIGEQRNRLSNKLGSQGSSESLSLFEDLRLQS EIAKARWESALQTLQQGKLQALRERQYLLIISQPMAESDTTRYADGTKWLLFFVLLGITY LVTSLLITIRRMRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vexD |
Synonyms | vexD; STY4652; t4345; Vi polysaccharide export inner-membrane protein VexD |
UniProt ID | P43111 |
◆ Recombinant Proteins | ||
OXT-1488H | Recombinant Human OXT, GST-tagged | +Inquiry |
MOGAT2-5626M | Recombinant Mouse MOGAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTLL10-4835R | Recombinant Rhesus Macaque TTLL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM183A-4951C | Recombinant Chicken FAM183A | +Inquiry |
IL20RB-4551H | Recombinant Human IL20RB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-706H | Native Human Transthyretin | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adrenal-2H | Human Adrenal Tissue Lysate | +Inquiry |
EFCAB4A-6708HCL | Recombinant Human EFCAB4A 293 Cell Lysate | +Inquiry |
TSPAN13-713HCL | Recombinant Human TSPAN13 293 Cell Lysate | +Inquiry |
Thalamus-519H | Human Thalamus Membrane Lysate | +Inquiry |
PIP4K2B-1353HCL | Recombinant Human PIP4K2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vexD Products
Required fields are marked with *
My Review for All vexD Products
Required fields are marked with *
0
Inquiry Basket