Recombinant Human IL20RB protein, His-tagged

• Cat.No.: IL20RB-4551H
• Product Overview: Recombinant Human IL20RB protein(Q6UXL0)(30-233aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 30-233aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.9 kDa
• AA Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IL20RB interleukin 20 receptor beta [ Homo sapiens ]
• Official Symbol: IL20RB
• Synonyms: IL20RB; interleukin 20 receptor beta; fibronectin type III domain containing 6 , FNDC6; interleukin-20 receptor subunit beta; DIRS1; IL 20R2; MGC34923; IL-20RB; IL-20R-beta; interleukin-20 receptor II; IL-20 receptor subunit beta; fibronectin type III domain containing 6; FNDC6; IL-20R2
• Gene ID: 53833
• mRNA Refseq: NM_144717
• Protein Refseq: NP_653318
• MIM: 605621
• UniProt ID: Q6UXL0