Recombinant Full Length Venezuelan Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL6433VF |
Product Overview : | Recombinant Full Length Venezuelan equine encephalitis virus Structural polyprotein Protein (P36330) (813-1254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (813-1254) |
Form : | Lyophilized powder |
AA Sequence : | YEHATTMPNQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPTI KCCGSQECTPTYRPDEQCKVFAGVYPFMWGGAYCFCDTENTQISKAYVMKSEDCLADHAA AYKAHTASVQALLNITVGEHSTVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQLRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEASVELAEQGSVTIHFSTAN IHPEFRLQICTSFVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATLVAMYVLTNQKHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Venezuelan equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | P36330 |
◆ Recombinant Proteins | ||
ETHE1-331H | Recombinant Human ETHE1, His tagged | +Inquiry |
Pdk3-4768M | Recombinant Mouse Pdk3 Protein, Myc/DDK-tagged | +Inquiry |
SH3PXD2A-2587H | Recombinant Human SH3PXD2A Protein (902-986 aa), His-Myc-tagged | +Inquiry |
RAMP1-421H | Recombinant Human receptor (G protein-coupled) activity modifying protein 1, His-tagged | +Inquiry |
RFL10992HF | Recombinant Full Length Esx-5 Secretion System Protein Eccb5(Eccb5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPSA-3969HCL | Recombinant Human NAPSA 293 Cell Lysate | +Inquiry |
PAPOLB-470HCL | Recombinant Human PAPOLB lysate | +Inquiry |
IL17RB-1115MCL | Recombinant Mouse IL17RB cell lysate | +Inquiry |
C18orf56-8218HCL | Recombinant Human C18orf56 293 Cell Lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket