Recombinant Full Length Esx-5 Secretion System Protein Eccb5(Eccb5) Protein, His-Tagged
Cat.No. : | RFL10992HF |
Product Overview : | Recombinant Full Length ESX-5 secretion system protein eccB5(eccB5) Protein (O53933) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MAEESRGQRGSGYGLGLSTRTQVTGYQFLARRTAMALTRWRVRMEIEPGRRQTLAVVASV SAALVICLGALLWSFISPSGQLNESPIIADRDSGALYVRVGDRLYPALNLASARLITGRP DNPHLVRSSQIATMPRGPLVGIPGAPSSFSPKSPPASSWLVCDTVATSSSIGSLQGVTVT VIDGTPDLTGHRQILSGSDAVVLRYGGDAWVIREGRRSRIEPTNRAVLLPLGLTPEQVSQ ARPMSRALFDALPVGPELLVPEVPNAGGPATFPGAPGPIGTVIVTPQISGPQQYSLVLGD GVQTLPPLVAQILQNAGSAGNTKPLTVEPSTLAKMPVVNRLDLSAYPDNPLEVVDIREHP STCWWWERTAGENRARVRVVSGPTIPVAATEMNKVVSLVKADTSGRQADQVYFGPDHANF VAVTGNNPGAQTSESLWWVTDAGARFGVEDSKEARDALGLTLTPSLAPWVALRLLPQGPT LSRADALVEHDTLPMDMTPAELVVPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-5 secretion system protein eccB5(eccB5) |
UniProt ID | O53933 |
◆ Native Proteins | ||
E2-01H | Native Human Estradiol (E2) | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
PYGB-03H | Native Human PYGB Protein | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLCXD2-3124HCL | Recombinant Human PLCXD2 293 Cell Lysate | +Inquiry |
SMURF2-1646HCL | Recombinant Human SMURF2 293 Cell Lysate | +Inquiry |
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
SPG11-1681HCL | Recombinant Human SPG11 cell lysate | +Inquiry |
RAB11FIP2-2629HCL | Recombinant Human RAB11FIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESX-5 secretion system protein eccB5(eccB5) Products
Required fields are marked with *
My Review for All ESX-5 secretion system protein eccB5(eccB5) Products
Required fields are marked with *
0
Inquiry Basket