Recombinant Human SH3PXD2A Protein (902-986 aa), His-Myc-tagged

• Cat.No.: SH3PXD2A-2587H
• Product Overview: Recombinant Human SH3PXD2A Protein (902-986 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 902-986 aa
• Description: Adapter protein involved in invadopodia and podosome formation, extracellular matrix degradation and invasiveness of some cancer cells. Binds matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs) and phosphoinositides. Acts as an organizer protein that allows NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ROS localization. In association with ADAM12, mediates the neurotoxic effect of amyloid-beta peptide.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.0 kDa
• AA Sequence: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SH3PXD2A SH3 and PX domains 2A [ Homo sapiens ]
• Official Symbol: SH3PXD2A
• Synonyms: SH3PXD2A; SH3 and PX domains 2A; FISH; five SH3 domains; KIAA0418; adapter protein TKS5; TKS5; SH3MD1
• Gene ID: 9644
• mRNA Refseq: NM_014631
• Protein Refseq: NP_055446
• UniProt ID: Q5TCZ1