Recombinant Full Length Upf0761 Membrane Protein Xoo3615(Xoo3615) Protein, His-Tagged
Cat.No. : | RFL899XF |
Product Overview : | Recombinant Full Length UPF0761 membrane protein XOO3615(XOO3615) Protein (Q5GWQ2) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MSRVKKLHQWKERLRDRARTVSFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFTNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFICIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMAAFRYQPEAMRLPTGFEIYGLL RLLGRFRQARIHGEGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQWLLARDL DLVPLAELYENCQLRVPIEDRPLPCRDDAYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | XOO3615 |
Synonyms | XOO3615; UPF0761 membrane protein XOO3615 |
UniProt ID | Q5GWQ2 |
◆ Recombinant Proteins | ||
RBM5-3578H | Recombinant Human RBM5 Protein, Myc/DDK-tagged | +Inquiry |
Chkb-885M | Recombinant Mouse Chkb Protein, MYC/DDK-tagged | +Inquiry |
DFFB-41H | Recombinant Human DFFB Protein, Q201-Q338, C-His tagged | +Inquiry |
MMP26-5430H | Recombinant Human MMP26 Protein, GST-tagged | +Inquiry |
YRKP-4132B | Recombinant Bacillus subtilis YRKP protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf51-8073HCL | Recombinant Human C2orf51 293 Cell Lysate | +Inquiry |
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
HADHA-2120HCL | Recombinant Human HADHA cell lysate | +Inquiry |
MAN2A1-4525HCL | Recombinant Human MAN2A1 293 Cell Lysate | +Inquiry |
Liver-106M | Mouse Liver Tissue Lysate (14 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All XOO3615 Products
Required fields are marked with *
My Review for All XOO3615 Products
Required fields are marked with *
0
Inquiry Basket