Recombinant Human MMP26 Protein, GST-tagged

Cat.No. : MMP26-5430H
Product Overview : Human MMP26 partial ORF ( NP_068573, 152 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMP26 matrix metallopeptidase 26 [ Homo sapiens ]
Official Symbol MMP26
Synonyms MMP26; matrix metallopeptidase 26; matrix metalloproteinase 26; matrix metalloproteinase-26; endometase; matrilysin 2; MGC126590; MGC126592; MMP-26; matrilysin-2;
Gene ID 56547
mRNA Refseq NM_021801
Protein Refseq NP_068573
MIM 605470
UniProt ID Q9NRE1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP26 Products

Required fields are marked with *

My Review for All MMP26 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon