Recombinant Human MMP26 Protein, GST-tagged

• Cat.No.: MMP26-5430H
• Product Overview: Human MMP26 partial ORF ( NP_068573, 152 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMP26 matrix metallopeptidase 26 [ Homo sapiens ]
• Official Symbol: MMP26
• Synonyms: MMP26; matrix metallopeptidase 26; matrix metalloproteinase 26; matrix metalloproteinase-26; endometase; matrilysin 2; MGC126590; MGC126592; MMP-26; matrilysin-2
• Gene ID: 56547
• mRNA Refseq: NM_021801
• Protein Refseq: NP_068573
• MIM: 605470
• UniProt ID: Q9NRE1