Recombinant Full Length Upf0397 Protein Smu_1935C(Smu_1935C) Protein, His-Tagged
Cat.No. : | RFL10650SF |
Product Overview : | Recombinant Full Length UPF0397 protein SMU_1935c(SMU_1935c) Protein (Q93D98) (1-181aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus mutans serotype c |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-181) |
Form : | Lyophilized powder |
AA Sequence : | MKNNSIKAVVATGIGAALFVIIGMFINIPLFANTSIQLQYAVQAFLAVIFGPVVGFFIGL IGHMVKDMFAGYGIWWSWVIPSGLVGLGIGFLRNRLHVEKGIFSTKDVVTFNIVQVLVNV LAWGVIAPLGDIIIFKEPASKVFVQGLLASVANALTVGVGATILLAIYAKSRTQAGSLSK D |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMU_1935c |
Synonyms | SMU_1935c; UPF0397 protein SMU_1935c |
UniProt ID | Q93D98 |
◆ Recombinant Proteins | ||
ESAM-3666H | Recombinant Human ESAM Protein (Gln30-Ala247), C-Fc tagged | +Inquiry |
H2AFJ-13644H | Recombinant Human H2AFJ, GST-tagged | +Inquiry |
EGFR-10H | Recombinant Human EGFR Protein, GST-tagged | +Inquiry |
IL2RA-5198H | Recombinant Human IL2RA Protein | +Inquiry |
ASCL1-386H | Recombinant Human ASCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
C11orf74-8335HCL | Recombinant Human C11orf74 293 Cell Lysate | +Inquiry |
LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
BTBD6-8396HCL | Recombinant Human BTBD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMU_1935c Products
Required fields are marked with *
My Review for All SMU_1935c Products
Required fields are marked with *
0
Inquiry Basket