Recombinant Full Length Uncharacterized Protein Rv2083/Mt2145(Rv2083, Mt2145) Protein, His-Tagged
Cat.No. : | RFL11150HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv2083/MT2145(Rv2083, MT2145) Protein (Q10691) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MTSIESHPEQYWAAAGRPGPVPLALGPVHPGGPTLIDLLMALFGLSTNADLGGANADIEG DDTDRRAHAADAARKFSANEANAAEQMQGVGAQGMAQMASGIGGALSGALGGVMGPLTQL PQQAMQAGQGAMQPLMSAMQQAQGADGLAAVDGARLLDSIGGEPGLGSGAGGGDVGGGGA GGTTPTGYLGPPPVPTSSPPTTPAGAPTKSATMPPPGGASPASAHMGAAGMPMVPPGAMG ARGEGSGQEKPVEKRLTAPAVPNGQPVKGRLTVPPSAPTTKPTDGKPVVRRRILLPEHKD FGRIAPDEKTDAGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv2083/MT2145(Rv2083, MT2145) |
UniProt ID | Q10691 |
◆ Recombinant Proteins | ||
C19ORF48-2129H | Recombinant Human C19ORF48 Protein (1-117 aa), GST-tagged | +Inquiry |
KLK1C2-2947R | Recombinant Rat KLK1C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR15-5192H | Recombinant Human GPR15 Protein, GST-tagged | +Inquiry |
CSNK1G2-2000H | Recombinant Human CSNK1G2 Protein, GST-tagged | +Inquiry |
FADS3-1807H | Recombinant Human FADS3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF2BP-5365HCL | Recombinant Human HSF2BP 293 Cell Lysate | +Inquiry |
ZCCHC24-201HCL | Recombinant Human ZCCHC24 293 Cell Lysate | +Inquiry |
PRR15-2814HCL | Recombinant Human PRR15 293 Cell Lysate | +Inquiry |
HAVCR1-2486CCL | Recombinant Canine HAVCR1 cell lysate | +Inquiry |
TMEM59L-938HCL | Recombinant Human TMEM59L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv2083/MT2145(Rv2083, MT2145) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv2083/MT2145(Rv2083, MT2145) Products
Required fields are marked with *
0
Inquiry Basket