Description :	This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.63 kDa
AA Sequence :	KFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Protein length :	261-360 a.a.

Gene Name	GPR15 G protein-coupled receptor 15 [ Homo sapiens ]
Official Symbol	GPR15
Synonyms	GPR15; G protein-coupled receptor 15; G-protein coupled receptor 15; BOB; brother of Bonzo; MGC126828; MGC126830;
Gene ID	2838
mRNA Refseq	NM_005290
Protein Refseq	NP_005281
MIM	601166
UniProt ID	P49685