Recombinant Full Length Uncharacterized Protein Rv0010C/Mt0013 (Rv0010C, Mt0013) Protein, His-Tagged
Cat.No. : | RFL32690HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) Protein (P71580) (1-141aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-141) |
Form : | Lyophilized powder |
AA Sequence : | MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAALGLILFASATWRARPR LAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEIETVSGGLLILSRWDLG TDPVEVLDALTAAGYAGRGQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) |
UniProt ID | P71580 |
◆ Recombinant Proteins | ||
Scarb1-699R | Recombinant Rat Scarb1 Protein, His/GST-tagged | +Inquiry |
TPO-50H | Active Recombinant Human TPO Protein, Animal Free | +Inquiry |
YCLG-3871B | Recombinant Bacillus subtilis YCLG protein, His-tagged | +Inquiry |
CTCF-1651R | Recombinant Rat CTCF Protein | +Inquiry |
MPZL2B-12033Z | Recombinant Zebrafish MPZL2B | +Inquiry |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRNN-405HCL | Recombinant Human CRNN cell lysate | +Inquiry |
HOXD8-5410HCL | Recombinant Human HOXD8 293 Cell Lysate | +Inquiry |
C9orf85-7923HCL | Recombinant Human C9orf85 293 Cell Lysate | +Inquiry |
TUBB6-646HCL | Recombinant Human TUBB6 293 Cell Lysate | +Inquiry |
LUC7L2-4606HCL | Recombinant Human LUC7L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013) Products
Required fields are marked with *
0
Inquiry Basket