Recombinant Full Length Escherichia Coli Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL15806EF |
Product Overview : | Recombinant Full Length Escherichia coli Flagellar biosynthetic protein flhB(flhB) Protein (P76299) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP VQPTHLPVPEALDFINEKPTHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; yecQ; b1880; JW1869; Flagellar biosynthetic protein FlhB |
UniProt ID | P76299 |
◆ Recombinant Proteins | ||
RFL14043BF | Recombinant Full Length Burkholderia Thailandensis Disulfide Bond Formation Protein B(Dsbb) Protein, His-Tagged | +Inquiry |
Sftpa1-8066R | Recombinant Rat Sftpa1 protein, His & T7-tagged | +Inquiry |
HLX-3634HF | Recombinant Full Length Human HLX Protein, GST-tagged | +Inquiry |
THOC2-1135Z | Recombinant Zebrafish THOC2 | +Inquiry |
CYP2E1-220H | Active Recombinant Human CYP2E1 Protein | +Inquiry |
◆ Native Proteins | ||
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-578M | MiniPig Stomach Lysate, Total Protein | +Inquiry |
FRMD6-284HCL | Recombinant Human FRMD6 lysate | +Inquiry |
HCT116-018WCY | Human Colon Colorectal Carcinoma HCT116 Whole Cell Lysate | +Inquiry |
TAP1-1254HCL | Recombinant Human TAP1 293 Cell Lysate | +Inquiry |
ACTN1-9056HCL | Recombinant Human ACTN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket