Recombinant Full Length Tolumonas Auensis Upf0761 Membrane Protein Tola_0461 (Tola_0461) Protein, His-Tagged
Cat.No. : | RFL5865TF |
Product Overview : | Recombinant Full Length Tolumonas auensis UPF0761 membrane protein Tola_0461 (Tola_0461) Protein (C4L9W1) (1-302aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tolumonas auensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-302) |
Form : | Lyophilized powder |
AA Sequence : | MTQDPRRLLALRNQRWAKSRLFCLRSRRFSAFFWRRVWHDRLPVLAGHLAYVSLLSIVPL LAVVFSVLSWLPRFSYFRRQFELFMFSNFVPETEIAFRYHFSLFVKNASKTTSIGLLMLV LLALLLIAAIDENMNHIWRCRGQRKWLKTITMYSIVLGVVPLLVGGSLLLSSQIQGWALW HYELVSSLGGGLLELLPYLLSLGGILLLYKVVPNIYVRWQHALLGATLAALLFEVAKEGF GYYIAHFGTYKSIYGALAGIPILMIWLYMSWLVVLLGAEFTATLGEWQLNRTLRGRKPRL PG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tola_0461 |
Synonyms | Tola_0461; UPF0761 membrane protein Tola_0461 |
UniProt ID | C4L9W1 |
◆ Recombinant Proteins | ||
TGFBR2-229H | Recombinant Human TGFBR2 protein, Fc-tagged | +Inquiry |
DFFB-1508R | Recombinant Rat DFFB Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP111A-016-3970S | Recombinant Staphylococcus aureus (strain: WBG8366, other: ST78-MRSA-IVa (2B)) SAP111A_016 protein, His-tagged | +Inquiry |
RFL24773OF | Recombinant Full Length Rabbit Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
TGFB1-37H | Recombinant Human/Bovine/Porcine TGFB1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
TF-103H | Native Human Apotransferrin | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAMD4-5759HCL | Recombinant Human GRAMD4 293 Cell Lysate | +Inquiry |
NOXA1-3749HCL | Recombinant Human NOXA1 293 Cell Lysate | +Inquiry |
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Tonsilla Cerebelli-539H | Human Tonsilla Cerebelli Membrane Lysate | +Inquiry |
CDK5R2-328HCL | Recombinant Human CDK5R2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tola_0461 Products
Required fields are marked with *
My Review for All Tola_0461 Products
Required fields are marked with *
0
Inquiry Basket