Recombinant Human TGFBR2 protein, Fc-tagged

• Cat.No.: TGFBR2-229H
• Product Overview: Recombinant Human TGFBR2, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Description: This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2
• Molecular Mass: 42.6kD
• AA Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
• Official Symbol: TGFBR2
• Synonyms: TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
• Gene ID: 7048
• mRNA Refseq: NM_003242
• Protein Refseq: NP_003233
• MIM: 190182
• UniProt ID: P37173