Native Human PIP Protein (118 aa)

• Cat.No.: PIP-20H
• Product Overview: Native protein isolated from pooled human seminal plasma, protein identity confirmed by LC-MS/MS.

Specification

• Species: Human
• Source: Seminal plasma
• ProteinLength: 118 aa
• Description: Enables IgG binding activity; aspartic-type endopeptidase activity; and identical protein binding activity. Involved in several processes, including detection of chemical stimulus involved in sensory perception of bitter taste; negative regulation of T cell apoptotic process; and proteolysis. Located in extracellular space and nucleus.
• Molecular Mass: 13.52 kDa
• AA Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
• Endotoxin: < 1.0 EU/μg
• Purity: >95%
• Applications: Western blotting, ELISA, Cell culture and/or animal studies, Immunological methods
• Quality Control Test: BCA to determine quantity of the protein.
  SDS PAGE to determine purity of the protein.
  LAL to determine quantity of endotoxin.
• Notes: All samples used for protein preparation were tested and found negative for HBsAg, HIV1,2, HCV, syphilis, aHBc, RRR. Since no test can absolutely assure the absence of all infectious agents, this product should be handled as a potential biohazard. This product is intended for research use only.
• Storage: Store the lyophilized protein at –80 centigrade. Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
• Storage Buffer: Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M phosphate buffer, 0.075M NaCl, pH 8.0.
• Reconstitution: Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
• Shipping: At ambient temperature.

Gene Information

• Gene Name: PIP prolactin induced protein [ Homo sapiens (human) ]
• Official Symbol: PIP
• Synonyms: PIP; prolactin induced protein; GPIP4; BRST-2; GCDFP15; GCDFP-15; prolactin-inducible protein; SABP; apocrine; gross cystic disease fluid protein 15; secretory actin-binding protein
• Gene ID: 5304
• mRNA Refseq: NM_002652
• Protein Refseq: NP_002643
• MIM: 176720
• UniProt ID: P12273