Recombinant Full Length Thermus Thermophilus Upf0365 Protein Tt_C0686(Tt_C0686) Protein, His-Tagged
Cat.No. : | RFL22855TF |
Product Overview : | Recombinant Full Length Thermus thermophilus UPF0365 protein TT_C0686(TT_C0686) Protein (Q72JT2) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermus Thermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYP LIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLE AVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVT TIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEA DKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYY RLKNIEADTDMRESISRAAKPEGEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TT_C0686 |
Synonyms | floA; TT_C0686; Flotillin-like protein FloA |
UniProt ID | Q72JT2 |
◆ Recombinant Proteins | ||
DDC-2428HF | Recombinant Full Length Human DDC Protein, GST-tagged | +Inquiry |
Il33-157M | Recombinant Mouse Il33 Protein | +Inquiry |
P2RX3A-9161Z | Recombinant Zebrafish P2RX3A | +Inquiry |
ARL9-824H | Recombinant Human ARL9 protein, GST-tagged | +Inquiry |
Il13-256I | Active Recombinant Mouse Il13 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRDMT1-695HCL | Recombinant Human TRDMT1 cell lysate | +Inquiry |
PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
Skin-444C | Cynomolgus monkey Skin Membrane Lysate | +Inquiry |
ADD1-9017HCL | Recombinant Human ADD1 293 Cell Lysate | +Inquiry |
GTF3C2-5690HCL | Recombinant Human GTF3C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TT_C0686 Products
Required fields are marked with *
My Review for All TT_C0686 Products
Required fields are marked with *
0
Inquiry Basket