Recombinant Human ARL9 protein, GST-tagged

• Cat.No.: ARL9-824H
• Product Overview: Human ARL9 full-length ORF ( NP_996802.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008]
• Molecular Mass: 40.2 kDa
• AA Sequence: MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL9 ADP ribosylation factor like GTPase 9 [ Homo sapiens (human) ]
• Official Symbol: ARL9
• Synonyms: ARL9; ADP ribosylation factor like GTPase 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9
• Gene ID: 132946
• mRNA Refseq: NM_206919
• Protein Refseq: NP_996802
• MIM: 612405
• UniProt ID: Q6T311