Recombinant Full Length Thermoanaerobacter Pseudethanolicus Upf0365 Protein Teth39_1136 (Teth39_1136) Protein, His-Tagged
Cat.No. : | RFL14790TF |
Product Overview : | Recombinant Full Length Thermoanaerobacter pseudethanolicus UPF0365 protein Teth39_1136 (Teth39_1136) Protein (B0K9H8) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermoanaerobacter pseudethanolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MTEFIFLLVVIGLIFVFLSVILSFIPLGLWISALAAGVKIGIFTLVGMRLRRVPPDKIVK PLIKAIKAGQDVEINKLEAHYLAGGNVDKVIDALIAAQRANISLEFERAAAIDLAGRDVL HAVQMSVNPKVIETPVVAAVAKDGIEVKVKARVTVRANIDRLVGGAGEETIIARVGEGIV TTVGSSNSHKEVLENPDSISRTVLNKGLDAGTAFEILSIDIADVDVGRNIGARLQIDQAE ADKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKAMAEALRTGKIGVMDY YNMRNVIADTMMRESFSKLGQERQQEEKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Teth39_1136 |
Synonyms | floA; Teth39_1136; Flotillin-like protein FloA |
UniProt ID | B0K9H8 |
◆ Recombinant Proteins | ||
TNFRSF9-5598H | Recombinant Human Tumor Necrosis Factor Receptor Superfamily, Member 9, His-tagged | +Inquiry |
GNA11-5807C | Recombinant Chicken GNA11 | +Inquiry |
SAP068A-007-1845S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) SAP068A_007 protein, His-tagged | +Inquiry |
ORAI1-3265H | Recombinant Human ORAI1 protein, His-tagged | +Inquiry |
LILRB4-309H | Recombinant Human LILRB4 protein, His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA2-7852HCL | Recombinant Human CAPZA2 293 Cell Lysate | +Inquiry |
SEMA4D-001CCL | Recombinant Cynomolgus SEMA4D cell lysate | +Inquiry |
ZNF280D-102HCL | Recombinant Human ZNF280D 293 Cell Lysate | +Inquiry |
GPAM-729HCL | Recombinant Human GPAM cell lysate | +Inquiry |
SPRYD4-1488HCL | Recombinant Human SPRYD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Teth39_1136 Products
Required fields are marked with *
My Review for All Teth39_1136 Products
Required fields are marked with *
0
Inquiry Basket