Recombinant Full Length Synechocystis Sp. Upf0754 Thylakoid Membrane Protein Sll0412(Sll0412) Protein, His-Tagged
Cat.No. : | RFL17992SF |
Product Overview : | Recombinant Full Length Synechocystis sp. UPF0754 thylakoid membrane protein sll0412(sll0412) Protein (Q55115) (23-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-419) |
Form : | Lyophilized powder |
AA Sequence : | GGIIGYFTNDLAIKMLFRPYKPLFLGPYQLPFTPGLIPRNQERLAKRVSDTIMGSLLTPE ELQRLARKLLQRERVEGALGWLLQLALKQIREDKQQKTAQILANILRDLFSESLPRLLKA LARQDNFLSDQINRIFDQILLEFRLSELQSRQFADWLLGTVLPPDTIRLALVDFLSDRNI QVIDEGFREKTSGTYWVVANLFGVRNSLTRLRAFCLEEKETANLRLKELLLSLEIRNRLK DWLQQLSLENLPVSTVRQLRRTTGEVVRTYIRERGEPLLKDFGSSVDWDNVAVLIVNRLQ SSTAVTGSLGLVSEELASILERYLEDDLEKIVKQIIPILAIDQVIINRINETPAAELETA VQAIVRSELQAIVNLGGVLGLIIGGLQTGFFLVSRGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sll0412 |
Synonyms | sll0412; UPF0754 thylakoid membrane protein sll0412 |
UniProt ID | Q55115 |
◆ Native Proteins | ||
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
SAA-152H | Native Human Serum Amyloid A Protein | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBG1-644HCL | Recombinant Human TUBG1 293 Cell Lysate | +Inquiry |
SYNGR1-1318HCL | Recombinant Human SYNGR1 293 Cell Lysate | +Inquiry |
Heart-25H | Human Heart Tissue Lysate | +Inquiry |
KCNIP4-5051HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sll0412 Products
Required fields are marked with *
My Review for All sll0412 Products
Required fields are marked with *
0
Inquiry Basket