Recombinant Human APLNR Protein, GST-tagged

• Cat.No.: AGTRAP-448H
• Product Overview: Human AGTRAP partial ORF ( NP_065083, 108 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.46 kDa
• AA Sequence: HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ]
• Official Symbol: AGTRAP
• Synonyms: AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646
• Gene ID: 57085
• mRNA Refseq: NM_001040194
• Protein Refseq: NP_001035284
• MIM: 608729
• UniProt ID: Q6RW13