Recombinant Full Length Synechococcus Sp. Upf0754 Membrane Protein Synpcc7002_A1087 (Synpcc7002_A1087) Protein, His-Tagged
Cat.No. : | RFL35703SF |
Product Overview : | Recombinant Full Length Synechococcus sp. UPF0754 membrane protein SYNPCC7002_A1087 (SYNPCC7002_A1087) Protein (B1XJW1) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MNFWTLLLPPIAGTVIGYFTNDIAINMLFRPYKAIYIGDRRLPFTPGLIPANQDRLARNI SRIIMGSLLTPEEIQKLAQKLLQTERIEAAIRWLLQLAFAQIQGEQEQKTAGILAAILRD LASESLPRLIKVWSREDTFLEAQVYQIFDQLLLDFKLTEAQARQLTDWLLRTVLTPDILR QATIDFLTDKNIEIIDTSLREKTSGTYWVVANLFGVKNSLTRLRAFCLEEREIANARLQE LILTLEIRLKLRLWLQGLSLQNLPVSTVRQLRKSFHQTIRQYFQNKGAGLMEYIGESVDW DNLSVVILRRLQASQVLDSSLGVVSQELSLLLDRYLEKDLEKIISQVIPILAIDQVIIER VNNTSPRELERAIQGIVKNELQAIVNLGGVLGFLVGVAQSVILLLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SYNPCC7002_A1087 |
Synonyms | SYNPCC7002_A1087; UPF0754 membrane protein SYNPCC7002_A1087 |
UniProt ID | B1XJW1 |
◆ Recombinant Proteins | ||
Pla2g4a-4901M | Recombinant Mouse Pla2g4a Protein, Myc/DDK-tagged | +Inquiry |
Spike-4650V | Active Recombinant COVID-19 Spike RBD Protein (R346S, N394S, Y449N, E484K, F490S, N501Y), His-Avi-tagged, Biotinylated | +Inquiry |
CDC34-0929H | Recombinant Human CDC34 Protein, GST-Tagged | +Inquiry |
CPEB1-625H | Recombinant Human CPEB1 Protein, His-tagged | +Inquiry |
GPC-757J | Recombinant Junin mammarenavirus GPC protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG2-7385HCL | Recombinant Human COG2 293 Cell Lysate | +Inquiry |
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Ovary-669H | Hamster Ovary Lysate, Total Protein | +Inquiry |
RHBDF2-2361HCL | Recombinant Human RHBDF2 293 Cell Lysate | +Inquiry |
COG1-378HCL | Recombinant Human COG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SYNPCC7002_A1087 Products
Required fields are marked with *
My Review for All SYNPCC7002_A1087 Products
Required fields are marked with *
0
Inquiry Basket