Recombinant Junin mammarenavirus GPC protein, His&Myc-tagged
Cat.No. : | GPC-757J |
Product Overview : | Recombinant Junin mammarenavirus GPC protein(P26313)(59-251aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | JUNV |
Source : | E.coli |
Tag : | N-His&C-Myc |
ProteinLength : | 59-251aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.8 kDa |
AASequence : | EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Native Proteins | ||
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM151A-996HCL | Recombinant Human TMEM151A 293 Cell Lysate | +Inquiry |
DDI2-220HCL | Recombinant Human DDI2 lysate | +Inquiry |
CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
XCL1-480MCL | Recombinant Mouse XCL1 cell lysate | +Inquiry |
C16orf13-8258HCL | Recombinant Human C16orf13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPC Products
Required fields are marked with *
My Review for All GPC Products
Required fields are marked with *
0
Inquiry Basket