Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL31799SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q2JNP5) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MVIYSLPLARWVSSLRRYFRHELLPLLADLRLAIGLLLAIAVLSATGTVIEQEETAAFYQ AHYPEHPALFGFLTWRVILSLGLDHVYRTPWFLAILILFGSSLAACSLTRQWPMLKRARR WSYLTRPQSFQRLPFRTYLPQQSLQGLPQQLRRQGYLVFQEGHYLYARKGLIGRIGPILV HVSMLLILLGAIWGSISGFKAQELIPSGGVASIQHLTGAGDLARAHLPTWQIRANRFWID YAADGRVKQFYSDLSILDQGQEVKRQTISVNHPLSYRGVTLYQADWSIDSIRIRINNSPT FQIPVVPVRTEAGNKLWGAFVPTQPDMSQGLTLLLPDLQGTALLYDTEGQWMGSLRQGMS LALDEVAPQRFPNPLTLYLDEVIGATGLQIKSDPGIPAVYLGFGLLMVGVVMSYFSYSQI WALQTETGLYLGGKTNRALVTFEREFDRLVEQQKVAFSLSQIPVEAEIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; CYB_0626; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q2JNP5 |
◆ Recombinant Proteins | ||
RFL7330AF | Recombinant Full Length African Swine Fever Virus Protein H108R(Mal-125) Protein, His-Tagged | +Inquiry |
Cd276-40RAF647 | Recombinant Rat Cd276 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
SRP19-12526Z | Recombinant Zebrafish SRP19 | +Inquiry |
CASR-3685H | Recombinant Human CASR protein, His-tagged | +Inquiry |
Spike-4733M | Active Recombinant MERS Spike RBD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI3-2035HCL | Recombinant Human PI3 cell lysate | +Inquiry |
RXRB-2098HCL | Recombinant Human RXRB 293 Cell Lysate | +Inquiry |
KDM4B-4995HCL | Recombinant Human KDM4B 293 Cell Lysate | +Inquiry |
Placenta-650B | Bovine Placenta Lysate, Total Protein | +Inquiry |
SMPD1-486MCL | Recombinant Mouse SMPD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket