Recombinant Full Length Synechococcus Elongatus Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL36957SF |
Product Overview : | Recombinant Full Length Synechococcus elongatus Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P31094) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus elongatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAIFDPSDAVLNPMWRQGM FVLPFMARLGVTQSWGGWSITGETAVDPGYWSFEGVAIAHIVLSGLLFLAAVWHWVYWDL ELFTDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLSGLWGPGMWVSDPYGLTGHVQP VAPAWGPEGFNPFNPGGIVAHHIAAGVVGIVAGLFHLTVRPPERLYKALRMGNIETVLSS SLAAVFFAAFVVAGTMWYGNAATPVELFGPTRYQWDQGYFRQEIARRVDTAVASGASLEE AWSSIPEKLAFYDYVGNSPAKGGLFRTGQMNKGDGIAQGWLGHAVFKDKNGDVLDVRRLP NFFENFPIVLTDSKGAVRADIPFRRAEAKFSFEETGITASFYGGSLNGQTITDPAQVKKY ARKAQLGEAFEFDTETLNSDGVFRTSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIEADLGEQIEFGAFQKLGDPTTRKTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Synpcc7942_0697; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P31094 |
◆ Recombinant Proteins | ||
GHITM-1494H | Recombinant Human GHITM | +Inquiry |
CENPA-1111H | Recombinant Human CENPA Protein, GST-Tagged | +Inquiry |
L5-4352H | Recombinant HAdV-11(strain BC34) L5 protein, His-tagged | +Inquiry |
PARS2-1115H | Recombinant Human PARS2 | +Inquiry |
FZD2-321H | Recombinant Human FZD2 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
LH-92P | Native Porcine LH | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3L-6853HCL | Recombinant Human DNMT3L 293 Cell Lysate | +Inquiry |
SNRPN-1658HCL | Recombinant Human SNRPN cell lysate | +Inquiry |
CTBP1-7216HCL | Recombinant Human CTBP1 293 Cell Lysate | +Inquiry |
C22orf29-108HCL | Recombinant Human C22orf29 lysate | +Inquiry |
IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket