Recombinant Full Length Trachelium Caeruleum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL23447TF |
Product Overview : | Recombinant Full Length Trachelium caeruleum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A9QC94) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trachelium caeruleum (Blue throatwort) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTIVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIINSWGGWGITGGTITYPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFTDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQY VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSTGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGAGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYNDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A9QC94 |
◆ Recombinant Proteins | ||
AYP1020-RS02360-5106S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS02360 protein, His-tagged | +Inquiry |
POLD4-301200H | Recombinant Human POLD4 protein, GST-tagged | +Inquiry |
SIRT7-5069R | Recombinant Rat SIRT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
VEGFC-601C | Recombinant Cattle VEGFC protein, His & T7-tagged | +Inquiry |
MYH1C-3808C | Recombinant Chicken MYH1C | +Inquiry |
◆ Native Proteins | ||
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMA5-968HCL | Recombinant Human LAMA5 cell lysate | +Inquiry |
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
KCNIP3-5054HCL | Recombinant Human KCNIP3 293 Cell Lysate | +Inquiry |
XPNPEP1-261HCL | Recombinant Human XPNPEP1 293 Cell Lysate | +Inquiry |
DHDPSL-6947HCL | Recombinant Human DHDPSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket