Recombinant Full Length Staphylococcus Epidermidis Sensor Protein Kinase Walk(Walk) Protein, His-Tagged
Cat.No. : | RFL27341SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Sensor protein kinase walK(walK) Protein (Q8CU87) (1-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-610) |
Form : | Lyophilized powder |
AA Sequence : | MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNSLEKELLDNFKKNITQYAKQLDVNI EKVYKDKDKGSVNAQKDIQDLLNEYANRQEIGEIRFIDKDQIIMATTKQSNRGLINQKVN DGSVQKALSLGQTNDHMVLKDYGSGKERVWVYNIPVKVDKQTIGDIYIESKINDVYNQLN NINQIFIVGTAISLFITVILGFFIARTITKPITDMRNQTVEMSKGNYTQRVKIYGNDEIG ELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGILATDRRGRVRIANDMALKMLGL AKEDVIGYYMLGVLNLENEFSLEEIQENSDSFLLDINEEEGIIARVNFSTIVQETGFVTG YIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWQDKELAPSFLSV TREETERMIRLVNDLLQLSKMDNESDQITKEIIDFNMFINKIINRHEMAAKDTTFVREIP QQTIFAEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQNALYNRMTIRIKDNGIGIPI NKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPC EIIEDGDWDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | walK |
Synonyms | walK; yycG; SE_0019; Sensor protein kinase WalK |
UniProt ID | Q8CU87 |
◆ Recombinant Proteins | ||
KRTAP5-1-8898M | Recombinant Mouse KRTAP5-1 Protein | +Inquiry |
SSP-RS06740-0276S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS06740 protein, His-tagged | +Inquiry |
RFL8825CF | Recombinant Full Length Dog Myelin Proteolipid Protein(Plp1) Protein, His-Tagged | +Inquiry |
CLN3-3252H | Recombinant Human CLN3 Protein, MYC/DDK-tagged | +Inquiry |
Malt1-26HCL | Recombinant Mouse Malt1 overexpression lysate | +Inquiry |
◆ Native Proteins | ||
IgM-01C | Native Cow IgM Protein | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS10-2386HCL | Recombinant Human RGS10 293 Cell Lysate | +Inquiry |
PNLIPRP1-909HCL | Recombinant Human PNLIPRP1 cell lysate | +Inquiry |
FRMD6-284HCL | Recombinant Human FRMD6 lysate | +Inquiry |
CTIF-903HCL | Recombinant Human CTIF cell lysate | +Inquiry |
MUC1-1980HCL | Recombinant Human MUC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All walK Products
Required fields are marked with *
My Review for All walK Products
Required fields are marked with *
0
Inquiry Basket