Recombinant Full Length Staphylococcus Aureus Sensor Protein Kinase Walk(Walk) Protein, His-Tagged
Cat.No. : | RFL29929SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein kinase walK(walK) Protein (Q2YUQ2) (1-608aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-608) |
Form : | Lyophilized powder |
AA Sequence : | MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV IEDGDWDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | walK |
Synonyms | walK; yycG; SAB0019; Sensor protein kinase WalK |
UniProt ID | Q2YUQ2 |
◆ Recombinant Proteins | ||
FIBCD1-272C | Recombinant Cynomolgus Monkey FIBCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CES3-3198H | Recombinant Human CES3 Protein, MYC/DDK-tagged | +Inquiry |
HSP90B1-3196H | Recombinant Human HSP90B1 Protein (Asp22-Ala311), N-His tagged | +Inquiry |
CTNNBIP1-1081R | Recombinant Rhesus monkey CTNNBIP1 Protein, His-tagged | +Inquiry |
MYH1C-3808C | Recombinant Chicken MYH1C | +Inquiry |
◆ Native Proteins | ||
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAALADL1-2589HCL | Recombinant Human NAALADL1 cell lysate | +Inquiry |
ESRRA-576HCL | Recombinant Human ESRRA cell lysate | +Inquiry |
IST1-358HCL | Recombinant Human IST1 lysate | +Inquiry |
DKC1-6916HCL | Recombinant Human DKC1 293 Cell Lysate | +Inquiry |
CSH2-7247HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All walK Products
Required fields are marked with *
My Review for All walK Products
Required fields are marked with *
0
Inquiry Basket