Recombinant Full Length Staphylococcus Epidermidis Sensor Protein Kinase Walk(Walk) Protein, His-Tagged
Cat.No. : | RFL23025SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Sensor protein kinase walK(walK) Protein (Q5HK19) (1-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-610) |
Form : | Lyophilized powder |
AA Sequence : | MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNSLEKELLDNFKKNITQYAKQLDVNI EKVYKDKDKGSVNAQKDIQDLLNEYANRQEIGEIRFIDKDQIIMATTKQSNRGLINQKVN DGSVQKALSLGQTNDHMVLKDYGSGKERVWVYNIPVKVDKQTIGDIYIESKINDVYNQLN NINQIFIVGTAISLFITVILGFFIARTITKPITDMRNQTVEMSKGNYTQRVKIYGNDEIG ELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGILATDRRGRVRIANDMALKMLGL AKEDVIGYYMLGVLNLENEFSLEEIQENSDSFLLDINEEEGIIARVNFSTIVQETGFVTG YIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWQDKELAPSFLSV TREETERMIRLVNDLLQLSKMDNESDQITKEIIDFNMFINKIINRHEMAAKDTTFVREIP QQTIFAEIDPDKMTQVFDNVITNAMKYSRGEKRVEFHVKQNALYNRMTIRIKDNGIGIPI NKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPC EIIEDGDWDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | walK |
Synonyms | walK; yycG; SERP2533; Sensor protein kinase WalK |
UniProt ID | Q5HK19 |
◆ Recombinant Proteins | ||
ZIK1-10382M | Recombinant Mouse ZIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
INHBC-02H | Recombinant Human INHBC Protein, N-His tagged | +Inquiry |
DCPS-01C | Recombinant Cynomolgus monkey DCPS Protein, His-tagged | +Inquiry |
SGR-RS06055-722S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS06055 protein, His-tagged | +Inquiry |
RFL21964HF | Recombinant Full Length Human Aquaporin-10(Aqp10) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
KLK4-238H | Native Human Kallikrein | +Inquiry |
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPA1-2478MCL | Recombinant Mouse CPA1 cell lysate | +Inquiry |
RIPPLY2-2331HCL | Recombinant Human RIPPLY2 293 Cell Lysate | +Inquiry |
AZGP1-1342HCL | Recombinant Human AZGP1 cell lysate | +Inquiry |
POLR1D-3040HCL | Recombinant Human POLR1D 293 Cell Lysate | +Inquiry |
ENG-2457HCL | Recombinant Human ENG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All walK Products
Required fields are marked with *
My Review for All walK Products
Required fields are marked with *
0
Inquiry Basket