Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Sausa300_1796(Sausa300_1796) Protein, His-Tagged
Cat.No. : | RFL13865SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SAUSA300_1796(SAUSA300_1796) Protein (Q2FFP9) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLNQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFNEKGKLIGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAUSA300_1796 |
Synonyms | SAUSA300_1796; UPF0754 membrane protein SAUSA300_1796 |
UniProt ID | Q2FFP9 |
◆ Recombinant Proteins | ||
KRTAP10-2-4828H | Recombinant Human KRTAP10-2 Protein, GST-tagged | +Inquiry |
CXCL10-186H | Active Recombinant Human CXCL10 Protein (Val22-Pro98), N-His tagged, Animal-free, Carrier-free | +Inquiry |
RIMO-1698B | Recombinant Bacillus subtilis RIMO protein, His-tagged | +Inquiry |
CCDC87-2902HF | Recombinant Full Length Human CCDC87 Protein, GST-tagged | +Inquiry |
PBLD2-12402M | Recombinant Mouse PBLD2 Protein | +Inquiry |
◆ Native Proteins | ||
ALPI-8348B | Native Bovine ALPI | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
EDN1-8305H | Native Human EDN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDOST-7024HCL | Recombinant Human DDOST 293 Cell Lysate | +Inquiry |
AMPK-412HCL | Recombinant Human AMPK cell lysate | +Inquiry |
bmMSCs-172H | bmMSCs(human bone marrow-derived mesenchymal stem cell) whole cell lysate | +Inquiry |
KCNK2-97HCL | Recombinant Human KCNK2 Lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAUSA300_1796 Products
Required fields are marked with *
My Review for All SAUSA300_1796 Products
Required fields are marked with *
0
Inquiry Basket