Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sausa300_0730(Sausa300_0730) Protein, His-Tagged
Cat.No. : | RFL11720SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized membrane protein SAUSA300_0730(SAUSA300_0730) Protein (Q2FIP5) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAUSA300_0730 |
Synonyms | SAUSA300_0730; Uncharacterized membrane protein SAUSA300_0730 |
UniProt ID | Q2FIP5 |
◆ Native Proteins | ||
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPYL6-1847HCL | Recombinant Human TSPYL6 cell lysate | +Inquiry |
RBMY1A1-2459HCL | Recombinant Human RBMY1A1 293 Cell Lysate | +Inquiry |
TRIM56-767HCL | Recombinant Human TRIM56 293 Cell Lysate | +Inquiry |
TRH-801HCL | Recombinant Human TRH 293 Cell Lysate | +Inquiry |
ITPRIP-5111HCL | Recombinant Human ITPRIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAUSA300_0730 Products
Required fields are marked with *
My Review for All SAUSA300_0730 Products
Required fields are marked with *
0
Inquiry Basket