Recombinant Full Length Oryza Sativa Subsp. Japonica Casp-Like Protein Os02G0578333(Os02G0578333, Loc_Os02G36845) Protein, His-Tagged
Cat.No. : | RFL512OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica CASP-like protein Os02g0578333(Os02g0578333, LOC_Os02g36845) Protein (Q6EP58) (1-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-201) |
Form : | Lyophilized powder |
AA Sequence : | MEAGEEIEDGEPSTPTYKAHHPPPHLPPPMRSSGVSLVLSVADLVLRFVAIGGTAGSAIA MATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVCAYLVLSLPASVVHVVRPGARSS RAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANWLGICQQFTSFCQRITASLVGSF AAAVVLVALVFLSALSLARRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os02g0578366 |
Synonyms | Os02g0578366; LOC_Os02g36845; B1267B06.3; B1342F01.34; OsJ_07255; Casparian strip membrane protein 7; OsCASP7 |
UniProt ID | Q6EP58 |
◆ Native Proteins | ||
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13RA1-2550HCL | Recombinant Human IL13RA1 cell lysate | +Inquiry |
RBM38-2472HCL | Recombinant Human RBM38 293 Cell Lysate | +Inquiry |
NAT8-3962HCL | Recombinant Human NAT8 293 Cell Lysate | +Inquiry |
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
DXO-232HCL | Recombinant Human DXO lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Os02g0578366 Products
Required fields are marked with *
My Review for All Os02g0578366 Products
Required fields are marked with *
0
Inquiry Basket