Recombinant Human FZD2

• Cat.No.: FZD2-26287TH
• Product Overview: Recombinant fragment corresponding to amino acids 192-245 of Human Frizzled 2 with an N terminal proprietary tag; predicted mwt: 31.57 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 54 amino acids
• Description: This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways.
• Molecular Weight: 31.570kDa inclusive of tags
• Tissue specificity: Widely expressed. In the adult, mainly found in heart, placenta, skeletal muscle, lung, kidney, pancreas, prostate, testis, ovary and colon. In the fetus, expressed in brain, lung and kidney. Low levels in fetal liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
• Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.

Gene Information

• Gene Name: FZD2 frizzled family receptor 2 [ Homo sapiens ]
• Official Symbol: FZD2
• Synonyms: FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2 , frizzled 2, seven transmembrane spanning receptor , frizzled homolog 2 (Drosophila); frizzled-2
• Gene ID: 2535
• mRNA Refseq: NM_001466
• Protein Refseq: NP_001457
• MIM: 600667
• Uniprot ID: Q14332
• Chromosome Location: 17q21.1
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem
• Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; protein heterodimerization activity