Recombinant Full Length Staphylococcus Aureus Putative Multidrug Export Atp-Binding/Permease Protein Sa1683(Sa1683) Protein, His-Tagged
Cat.No. : | RFL26051SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SA1683(SA1683) Protein (Q7A4T3) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SA1683 |
Synonyms | SA1683; Putative multidrug export ATP-binding/permease protein SA1683 |
UniProt ID | Q7A4T3 |
◆ Recombinant Proteins | ||
RFL25606PF | Recombinant Full Length Pan Troglodytes Reticulon-1(Rtn1) Protein, His-Tagged | +Inquiry |
LPCAT3-9198M | Recombinant Mouse LPCAT3 Protein | +Inquiry |
EPOR-241H | Recombinant Human EPOR Protein, Fc-tagged | +Inquiry |
FBXL15-3141M | Recombinant Mouse FBXL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT1-181H | Active Recombinant Human PRMT1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
MYH-10B | Active Native Bovine Myosin Protein | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM45A-949HCL | Recombinant Human TMEM45A 293 Cell Lysate | +Inquiry |
BBX-159HCL | Recombinant Human BBX cell lysate | +Inquiry |
OCM2-3602HCL | Recombinant Human OCM2 293 Cell Lysate | +Inquiry |
ACSL4-9074HCL | Recombinant Human ACSL4 293 Cell Lysate | +Inquiry |
Lymphoma-335H | Human Lymphoma, Non-Hodgkins Disease Membrane Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SA1683 Products
Required fields are marked with *
My Review for All SA1683 Products
Required fields are marked with *
0
Inquiry Basket