Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL25353SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q2FGW1) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETSK NEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNSG KANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SAUSA300_1370; Elastin-binding protein EbpS |
UniProt ID | Q2FGW1 |
◆ Recombinant Proteins | ||
AIRE-3784H | Recombinant Human AIRE, His-tagged | +Inquiry |
ITGAV&ITGB6-759H | Active Recombinant Human ITGAV&ITGB6 protein, His-tagged | +Inquiry |
SERINC3-324H | Recombinant Human SERINC3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SBDS-5234R | Recombinant Rat SBDS Protein | +Inquiry |
OTUD1-3772H | Recombinant Human OTUD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
Lecithin-08E | Native Egg Yolk Lecithin | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTSJ2-6123HCL | Recombinant Human FTSJ2 293 Cell Lysate | +Inquiry |
LNCaP-995H | LNCaP (human prostate carcinoma) nuclear extract lysate | +Inquiry |
PYGM-2644HCL | Recombinant Human PYGM 293 Cell Lysate | +Inquiry |
GSTO1-761HCL | Recombinant Human GSTO1 cell lysate | +Inquiry |
TMEM108-1014HCL | Recombinant Human TMEM108 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket