Recombinant Full Length Shewanella Oneidensis Upf0114 Protein So_3997(So_3997) Protein, His-Tagged
Cat.No. : | RFL25529SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis UPF0114 protein SO_3997(SO_3997) Protein (Q8EAB0) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHILPIIFEMTEVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMDVKNIDNDKIMWYLLIHITFVLSAFAMGYLDKMTRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SO_3997 |
Synonyms | SO_3997; UPF0114 protein SO_3997 |
UniProt ID | Q8EAB0 |
◆ Recombinant Proteins | ||
MTMR10-5785M | Recombinant Mouse MTMR10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLP7-1291M | Recombinant Mouse-ear cress NLP7 protein, His-tagged | +Inquiry |
hly-243 | Active Recombinant Listeriolysin O, PEST Free | +Inquiry |
ADAM15-277H | Recombinant Human ADAM15 Protein, GST-tagged | +Inquiry |
KRIT1-9975Z | Recombinant Zebrafish KRIT1 | +Inquiry |
◆ Native Proteins | ||
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSTM1-2608HCL | Recombinant Human OSTM1 cell lysate | +Inquiry |
ZBTB24-742HCL | Recombinant Human ZBTB24 lysate | +Inquiry |
Lung-316G | Guinea Pig Lung Lysate | +Inquiry |
GALT-6026HCL | Recombinant Human GALT 293 Cell Lysate | +Inquiry |
CNTN1-996MCL | Recombinant Mouse CNTN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SO_3997 Products
Required fields are marked with *
My Review for All SO_3997 Products
Required fields are marked with *
0
Inquiry Basket