Recombinant Human ADAM15 Protein, GST-tagged

• Cat.No.: ADAM15-277H
• Product Overview: Human ADAM15 partial ORF ( AAH14566, 301 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.73 kDa
• AA Sequence: AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM15 ADAM metallopeptidase domain 15 [ Homo sapiens ]
• Official Symbol: ADAM15
• Synonyms: ADAM15; ADAM metallopeptidase domain 15; a disintegrin and metalloproteinase domain 15 (metargidin); disintegrin and metalloproteinase domain-containing protein 15; MDC15; metargidin; MDC-15; ADAM 15; metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15
• Gene ID: 8751
• mRNA Refseq: NM_003815
• Protein Refseq: NP_003806
• MIM: 605548
• UniProt ID: Q13444