Recombinant Full Length Shewanella Oneidensis Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL8752SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q8EIL8) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MTKPLLEVSACYRSFQAGEQQLTVLKDINLSIARGEMVAIVGASGSGKSTLMNILGCLDK PSKGAYFIDGQDTSQMDVDELAKLRREHFGFIFQRYHLLGDLNAVGNVEVPAVYAGKDRL ERRDRAESLLSRLGLGERLDHKPNQLSGGQQQRVSVARALMNGGDVILADEPTGALDSHS GEEMMRLLQELHREGHTIIIVTHDMHVAQHADRIIEIKDGVIISDEPNLASQTAVKAQVD MSLAKPSGATRVAAWDRYAEALKMALLAMSTHRLRTFLTMLGIIIGIASVVSVVALGEGS QREILKSISSMGTNTIDIRPGLGFGDRRSARVRTLTASDANALKNLPYVDSVTPSISSSV TVRLGNKAVTASVNGVGPEFFRVRGYELAQGQFWDDDSVDALAQDAVIDDNTRKQLFPDS TGAMGSVIGQVIFLGDLPVRIIGVTKPKESAFGNSDALNVWVPYTTVSGRMVGKKYLDGI TVRLDESVPSNAAEQGIITLLKMRHGTQDFFTINTDTIRQNIEKTTATMTLLISAIAVIS LVVGGIGVMNIMLVSVTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGALGVALAY LIGVVFAQAGGSFQMIYSTTSIVAAFACSTLIGVLFGFLPARNAARLDPVEALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; SO_0821; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q8EIL8 |
◆ Recombinant Proteins | ||
WISP3-10185M | Recombinant Mouse WISP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL23a-3335R | Recombinant Rat IL23a protein, His-GST-tagged | +Inquiry |
Wee2-6993M | Recombinant Mouse Wee2 Protein, Myc/DDK-tagged | +Inquiry |
CCDC90B-1202R | Recombinant Rat CCDC90B Protein | +Inquiry |
CALM1-01H | Active Recombinant Human CALM1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZHX2-167HCL | Recombinant Human ZHX2 293 Cell Lysate | +Inquiry |
HHLA2-5569HCL | Recombinant Human HHLA2 293 Cell Lysate | +Inquiry |
PLGRKT-7928HCL | Recombinant Human C9orf46 293 Cell Lysate | +Inquiry |
PRPH2-2821HCL | Recombinant Human PRPH2 293 Cell Lysate | +Inquiry |
CPSF3L-7303HCL | Recombinant Human CPSF3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket