Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL3777NF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q5MK06) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria gonorrhoeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MSLIECKNINRYFGSGENRVHILKDISLSIEKGDFVAIIGQSGSGKSTLMNILGCLDTAG SGSYRIDGIETAKMQPDELAALRRERFGFIFQRYNLLSSLTARDNVALPAVYMGMGGKER SARADKLLQDLGLASKEGNKPGELSGGQQQRVSIARALMNGGEIIFADEPTGALDTASGK NVMEIIRRLHEAGHTVIMVTHDPGIAANANRVIEIRDGEIISDTSKNPEIPASNVGRIQE KASWSFYYDQFVEAFRMSVQAVLAHKMRSLLTMLGIIIGIASVVSVVALGNGSQKKILED ISSMGTNTISIFPGRGFGDRRSGKIKTLTIDDAKIIAKQSYVASATPMTSSGGTLTYRNT DLTASLYGVGEQYFDVRGLKLETGRLFDENDVKEDAQVVVIDQNVKDKLFADSDPLGKTI LFRKRPLTVIGVMKKDENAFGNSDVLMLWSPYTTVMHQITGESHTNSITVKIKDNANTRV AEKGLAELLKARHGTEDFFMNNSDSIRQMVESTTGTMKLLISSIALISLVVGGIGVMNIM LVSVTERTKEIGIRMAIGARRGNILQQFLIEAVLICIIGGLVGVGLSAAVSLVFNHFVTD FPMDISAASVIGAVACSTGIGIAFGFMPANKAAKLNPIDALAQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q5MK06 |
◆ Recombinant Proteins | ||
NOTUM1B-755Z | Recombinant Zebrafish NOTUM1B | +Inquiry |
THAP8-893H | Recombinant Human THAP8 Protein, His-tagged | +Inquiry |
FBL-3130M | Recombinant Mouse FBL Protein, His (Fc)-Avi-tagged | +Inquiry |
Tetra-Ubiquitin-42H | Recombinant Human Tetra-Ubiquitin Protein (K48-Linked), Fluorescein-Labeled | +Inquiry |
EPHA5-3388H | Active Recombinant Human EPHA5 Protein, GST/His-tagged | +Inquiry |
◆ Native Proteins | ||
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1IP1-7717HCL | Recombinant Human CCNB1IP1 293 Cell Lysate | +Inquiry |
FBXW5-610HCL | Recombinant Human FBXW5 cell lysate | +Inquiry |
CDH2-971MCL | Recombinant Mouse CDH2 cell lysate | +Inquiry |
CLMP-2805HCL | Recombinant Human CLMP cell lysate | +Inquiry |
EBPL-6732HCL | Recombinant Human EBPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket