Recombinant Full Length Sheep Antigen-Presenting Glycoprotein Cd1D(Cd1D) Protein, His-Tagged
Cat.No. : | RFL4802OF |
Product Overview : | Recombinant Full Length Sheep Antigen-presenting glycoprotein CD1d(CD1D) Protein (O62848) (18-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (18-335) |
Form : | Lyophilized powder |
AA Sequence : | SFEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRDIREFVKMLPGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETVHWLLHDICPELVKGLMQTGKSELEKQVKPEAWLSSGPSPGPDRLLLGCHVSGFYPKPVWVMWMRGEQEEPGTQQGDVMPNADSTWYLRVTLEVAAGEAAGLSCRVKHSSLGDQDIILYWDGKRVSRGLIVVLVILVFVLLFVGGLVFWFRKHRRYQDIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD1D |
Synonyms | CD1D; Antigen-presenting glycoprotein CD1d; CD antigen CD1d |
UniProt ID | O62848 |
◆ Recombinant Proteins | ||
CD1D-828H | Recombinant Human CD1D Protein, Fc-tagged | +Inquiry |
CD1D-166H | Recombinant Human CD1D Protein, C-His-tagged | +Inquiry |
CD1D-3515S | Recombinant Sylvilagus floridanus (Cottontail rabbit) CD1D, His-tagged | +Inquiry |
CD1D-64HF | Recombinant Full Length Human CD1D Protein | +Inquiry |
CD1D-550R | Recombinant Rhesus Macaque CD1D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
0
Inquiry Basket