Recombinant Human CD1D Protein, C-His-tagged
Cat.No. : | CD1D-166H |
Product Overview : | Recombinant Human CD1D Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The CD1 multigene family encodes five forms of the CD1 T cell surface glycoprotein in human, designated CD1A, 1B, 1C, 1D and 1E. CD1, a type 1 membrane protein, has structural similarity to the MHC class I antigen and has been shown to present lipid antigens for recognition by T lymphocytes. CD1 antigens are associated with β-2-Microglobulin and expressed on cortical thymocytes, Langerhans cells, a B cell subset and some dendritic cells. Adaptor protein complexes and CD1-associated chaperones control CD1 trafficking and the development and activation of CD1-restricted T cells. CD1D is present on human intestinal epithelial cells (IEC) and exists as a β-2-Microglobulinindependent nonglycosylated form or a β-2-Microglobulin-dependent glycosylated form. The human CD1D gene maps to chromosome 1q23.1 and encodes a 335 amino acid protein that influences normal T cell maturation. |
Molecular Mass : | ~31 kDa |
AA Sequence : | EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD1D CD1d molecule [ Homo sapiens (human) ] |
Official Symbol | CD1D |
Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D; R3; CD1A; MGC34622; |
Gene ID | 912 |
mRNA Refseq | NM_001766 |
Protein Refseq | NP_001757 |
MIM | 188410 |
UniProt ID | P15813 |
◆ Recombinant Proteins | ||
CD1d-0916H | Recombinant Human CD1d Protein (Glu20-Ser301), N-His tagged | +Inquiry |
CD1D-64HF | Recombinant Full Length Human CD1D Protein | +Inquiry |
CD1D-5279H | Recombinant Human CD1D Protein (Met1-Ser301), C-His tagged | +Inquiry |
RFL31371HF | Recombinant Full Length Human Antigen-Presenting Glycoprotein Cd1D(Cd1D) Protein, His-Tagged | +Inquiry |
CD1D-828H | Recombinant Human CD1D Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
0
Inquiry Basket