Recombinant Human CD1D

Cat.No. : CD1D-27107TH
Product Overview : Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 335 amino acids
Description : This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail.
Molecular Weight : 62.590kDa inclusive of tags
Tissue specificity : Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL
Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name CD1D CD1d molecule [ Homo sapiens ]
Official Symbol CD1D
Synonyms CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d;
Gene ID 912
mRNA Refseq NM_001766
Protein Refseq NP_001757
MIM 188410
Uniprot ID P15813
Chromosome Location 1q22-q23
Pathway Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function beta-2-microglobulin binding; exogenous lipid antigen binding; histone binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD1D Products

Required fields are marked with *

My Review for All CD1D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon