Recombinant Human CD1D
Cat.No. : | CD1D-27107TH |
Product Overview : | Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 335 amino acids |
Description : | This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. |
Molecular Weight : | 62.590kDa inclusive of tags |
Tissue specificity : | Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
Gene Name | CD1D CD1d molecule [ Homo sapiens ] |
Official Symbol | CD1D |
Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; |
Gene ID | 912 |
mRNA Refseq | NM_001766 |
Protein Refseq | NP_001757 |
MIM | 188410 |
Uniprot ID | P15813 |
Chromosome Location | 1q22-q23 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | beta-2-microglobulin binding; exogenous lipid antigen binding; histone binding; receptor activity; |
◆ Recombinant Proteins | ||
CD1d-0916H | Recombinant Human CD1d Protein (Glu20-Ser301), N-His tagged | +Inquiry |
CD1D-64HF | Recombinant Full Length Human CD1D Protein | +Inquiry |
CD1D-550R | Recombinant Rhesus Macaque CD1D Protein, His (Fc)-Avi-tagged | +Inquiry |
CD1D-5279H | Recombinant Human CD1D Protein (Met1-Ser301), C-His tagged | +Inquiry |
CD1D-828H | Recombinant Human CD1D Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
0
Inquiry Basket