Recombinant Full Length Serpentine Receptor Class X 45(Srx-45) Protein, His-Tagged
Cat.No. : | RFL26458CF |
Product Overview : | Recombinant Full Length Serpentine receptor class X 45(srx-45) Protein (P34490) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MFQILMENVEVQHIDRIAALLIFFTSFIGFACNTFIAFYIRRLSLLRNSFGRLLQLQAAG DAVFVLVWAFYFAPVLFFDIKPLQSLAIAARFAQLCLICYDISIYTHLVISLNRFISLYF PTSYQNIFTERFTTFLICSIIFVSFGFSWFLVIRDCQMGFSIPRWMLDYVSPPCEMINVY YAEFFRGLIVISMFAITNSFTFCRMHMHNRKKQTATVFETTQQKKRRAVETRFVQQVTMQ GLLYVIELVTYFYISLRFPVPLEPVELAKSSNRWPNFLLTTYAWILVHALDGVITLIFNK QFRSVLRHPCRSQEALNISKTPSRRSRFTTNRDESNRKKSSILACTFISNSNTGYGSSVH V |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srx-45 |
Synonyms | srx-45; K01B6.2; Serpentine receptor class X 45; Protein srx-45 |
UniProt ID | P34490 |
◆ Native Proteins | ||
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-663G | Guinea Pig Testis Lysate, Total Protein | +Inquiry |
PPP6R2-1560HCL | Recombinant Human PPP6R2 cell lysate | +Inquiry |
TCF3-1180HCL | Recombinant Human TCF3 293 Cell Lysate | +Inquiry |
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
ECT2-6728HCL | Recombinant Human ECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srx-45 Products
Required fields are marked with *
My Review for All srx-45 Products
Required fields are marked with *
0
Inquiry Basket